PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02246.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 271aa    MW: 31099.9 Da    PI: 8.6703
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02246.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.2e-50151392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+  + ++kewyfF+ r +ky+++ r+nr+t sg+Wkatg
  Rsa1.0_02246.1_g00004.1  15 LPGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFNPWDLPRVSSVGQKEWYFFCMRGRKYKNSVRPNRVTGSGFWKATG 99 
                              69***************************.99***************77777999******************************* PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               dk+v+s +   vglkk+Lv+y g+a kg+ktdW+mhe+rl
  Rsa1.0_02246.1_g00004.1 100 IDKPVYS-NFDCVGLKKSLVYYLGSAGKGSKTDWMMHEFRL 139
                              *******.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.78714163IPR003441NAC domain
SuperFamilySSF1019411.23E-5514162IPR003441NAC domain
PfamPF023652.3E-2516139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MSGEGKDEEE DEAILPGFRF HPTDEELLGY YLRRKVENKP IKLELIKQID IYKFNPWDLP  60
RVSSVGQKEW YFFCMRGRKY KNSVRPNRVT GSGFWKATGI DKPVYSNFDC VGLKKSLVYY  120
LGSAGKGSKT DWMMHEFRLS STTKTDSRAQ QAEVWTLCRI FKRVTHKRNP TTIQPNRKPV  180
ITLTDSCSKS SSLDSDNTSH RVVDSLSHKL HETQTENPYW NQLTTVGFGQ PTYACNDNNF  240
LSFLNIDGGD FIGDSASWDE LRSVIDGNTK H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-521316316165NO APICAL MERISTEM PROTEIN
1ut4_B1e-521316316165NO APICAL MERISTEM PROTEIN
1ut7_A1e-521316316165NO APICAL MERISTEM PROTEIN
1ut7_B1e-521316316165NO APICAL MERISTEM PROTEIN
4dul_A1e-521316316165NAC domain-containing protein 19
4dul_B1e-521316316165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133561.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK551e-168NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM4C7V40.0M4C7V4_BRARP; Uncharacterized protein
STRINGBra000282.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-155NAC domain containing protein 42